SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221263|ref|YP_007105433.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221263|ref|YP_007105433.1|
Domain Number 1 Region: 8-337
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-114
Family TK-like PP module 0.00000000158
Further Details:      
 
Domain Number 2 Region: 354-529
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.45e-60
Family TK-like Pyr module 0.000000976
Further Details:      
 
Domain Number 3 Region: 533-664
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.54e-47
Family Transketolase C-terminal domain-like 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221263|ref|YP_007105433.1|
Sequence length 664
Comment transketolase [Synechococcus sp. PCC 7502]
Sequence
MAVVTQSLEQLCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLFDQFLKFNPKNPKWV
DRDRFVLSAGHGCMLQYALLHLTGYDSVSIDDIKQFRQWGSPTPGHPENFETAGVEVTTG
PLGQGVGNAVGLAIAEAHLAARFNKPGHNIVDHYTYVILGDGCNMEGIASEAASLGGHLK
LGKLIMLYDSNSISIDGSTDLAFTEDVGKRYEAYGWHVTYVTDGNNDLDAIAKALEESKS
VKDKPSLIVVTTTIGYGSPKKAGTAGVHGAMLGTDEVAATRANLGWEYEPFVVPEDAYTR
FHKAIAKGAEAEAEWNERFAAYEKAYPAEATEYKRIMAGELPEGWEKALEPVAQKETSTR
LLSEACLNALSPILPEFLGGSADLAHSNMTYVKGLPDFQPGSYEGRNFRFGVREHGMGAI
LNGMILHGGTIPYGATFLVFADYMRGAIRLSALSEVGVLYILTHDSVMLGEDGPTHQPVE
TLASLRVIPNLLVLRPADAKETVGVYQVAIANRKRPSALAFTRQNVKNLPGTSIEGTKKG
GYIVVDAPNPELIFIATGSEVELAVKAAAILTSEGKAVRVVSMPSQELYNEQSDEYKESV
LPASVKKRVSVEAGSTFGWHKYVGSEGAVIGMDTFGASAPGPVVYEKFGFTVDNIIATAR
KVLG
Download sequence
Identical sequences K9SSW7
WP_015167957.1.58188 gi|428221263|ref|YP_007105433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]