SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221351|ref|YP_007105521.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221351|ref|YP_007105521.1|
Domain Number 1 Region: 39-363
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.61e-39
Family Pectate transeliminase 0.024
Further Details:      
 
Weak hits

Sequence:  gi|428221351|ref|YP_007105521.1|
Domain Number - Region: 471-502
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.000196
Family Sporulation related repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221351|ref|YP_007105521.1|
Sequence length 506
Comment parallel beta-helix repeat (two copies) [Synechococcus sp. PCC 7502]
Sequence
MLKHISTGVLISLFLGGVNGVSAQTKTLIRNQPVVPKLNIIYVNPVTGNDRTGKGSIAAP
FRSITYALAEAKYATIIKLRAGTYTIANGEIFPLQLKAGVIVEGNESKQGQDTVILGGGN
FLSPTLTAQNITVLGANFAELRGVTITNKNPRGYGLWLEGTSPRILSNTFSGNTQDGILI
LGKSAAVISKNVFITNGANGMSIEGEAQPEISSNRFENTGYGLIIRQNAAPRIVSNVLRN
NRSGILIQPSSTPIIRNNLIEGNRQTGITILGNSSPDLGNADSLGNNRIRNNLLRDVQYT
GTEAIAAVGNEISRLSGNIQLSGTLQSQPLSVPNISSAPNVSPNLPNGVTRTIIPNSVIV
RTLPIESTQPLPLNTKIDPTLPPIALTPPTGVPIKSPDKPTGLNNPNPTILPPPSSSSGT
NSRTIIITRAKPTAPVTLRYRVVVSANSESSKLEIRRIVPTAFTARMNGQEVIQVGAFSD
RTAADEQVKILAQAGFNAEVESIGGQ
Download sequence
Identical sequences K9STY3
WP_015168044.1.58188 gi|428221351|ref|YP_007105521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]