SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221368|ref|YP_007105538.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221368|ref|YP_007105538.1|
Domain Number 1 Region: 7-206
Classification Level Classification E-value
Superfamily GAF domain-like 1e-28
Family GAF domain 0.00064
Further Details:      
 
Domain Number 2 Region: 406-518
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000044
Family HD domain 0.09
Further Details:      
 
Domain Number 3 Region: 216-329
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000298
Family HD domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221368|ref|YP_007105538.1|
Sequence length 551
Comment HD-GYP domain-containing protein [Synechococcus sp. PCC 7502]
Sequence
MNEDYIERFAKLNAIGIALSAETDPKSLIEMIVMGAKSLTNADGGTLYMVTKDQDALERK
LKFEIMITDSLGIKMGGTTGKSIPLGPIPLYHGDRTPNSSMIAAYSAIHRKTINIPDAYT
AEGFDFSGTRAFDQQTGYRSKSFLTVPMKNHENEIIGVLQLINAIDPNTQEIIPFSQQSQ
HLAESLASQAAVALTNRELVEEFRLLFESFIGLIAKAIDDKSPYTGGHCRRVPVLTMLLA
QAACETDQGIFKDFKMTEEELYELKIAGLLHDCGKVVTPVHIVDKATKLETIYDRIHLID
TRFEVLKRDAEIKYLKEKIAILEGHDQTTPLTETLSELEINHQNYLQQLESDRQFLRFCN
IGSERMSDQDKARLREMQKYRWINEHGEDVPFLTEDEFYNLDITFGTLTNEERQIINDHM
KVTIEMLEALPYPKNLRRVPEYASGHHERMDGKGYPRGLTREQMSIPARMMGIADIFEAL
SATDRPYKKGKTLTECLHILGKMKLNSHIDPDLFDLFINEKVYLKYAEEFIATDQIDDVD
LTKIPGYTPST
Download sequence
Identical sequences K9ST47
gi|428221368|ref|YP_007105538.1| WP_015168061.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]