SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221436|ref|YP_007105606.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221436|ref|YP_007105606.1|
Domain Number 1 Region: 192-271
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-20
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 20-127
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000002
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 119-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000821
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221436|ref|YP_007105606.1|
Sequence length 300
Comment 30S ribosomal protein S1 [Synechococcus sp. PCC 7502]
Sequence
MNTKTPKQSFSMSDFADALVAHDYEFKVGQIVKGKVIAHESRGSYIDIGGKSPGFLPIDE
ATTKASGISASDLAELLPIDSDREFMIISDQDADGEVKLSIRLLKIKQAWLNLQDLQAEG
KAFNCRVINVNKGGVVADVQGIRGFIPRSHLVDKVNMNDLVGKTLSVVLVELDQTRNKLV
LSNTQAVKASAMSQLSKGQLVTGTVTSLRPFGAFIDFGGVTGLLHIKEISQKYIGDVNSV
FAIGEPIKAVILDIDESRNRISLSTKILENHAGEFIDQREQVLAEAEQRLETNISKLWNS
Download sequence
Identical sequences K9SU50
gi|428221436|ref|YP_007105606.1| WP_015168129.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]