SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221592|ref|YP_007105762.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221592|ref|YP_007105762.1|
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 5.76e-56
Family Aldo-keto reductases (NADP) 0.00078
Further Details:      
 
Weak hits

Sequence:  gi|428221592|ref|YP_007105762.1|
Domain Number - Region: 320-354
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0039
Family 7-Fe ferredoxin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428221592|ref|YP_007105762.1|
Sequence length 375
Comment putative oxidoreductase of aldo/keto reductase family [Synechococcus sp. PCC 7502]
Sequence
MRDRRFGKTEMNLSVFSFGTMRYLESEANAVATTFKAVELGINHLETAKGYGKSEVYIGA
AFKAGLKQQRERLIVTTKIPPTKDAGTMRQFIKESLQKLQLDYIDNFDIHGINTWEHIEM
VKQPNGCMQAVREAMQAGLIRHVGFSTHGSLEVIMGAIATDLFESVNLHYYYFNQRNAPA
IALAHQKDMGVFIISPSDKGGMLYDPPAKLQQLCHPYTPVELNARFLLADPRIHTLSLGA
ANPQEFDSHKRVWDNDQPLSELEQSLLKNLDTQYLALGSDRCSQCYACLPCPENINIPEV
LRLRNLAIAFDMEEFGKYRYKMFENAGHWFPGAKANKCNDCSDCLPRCPENLNIPDLLRD
THNRLHTQDGKRLWE
Download sequence
Identical sequences K9SSM0
gi|428221592|ref|YP_007105762.1| WP_015168285.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]