SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221713|ref|YP_007105883.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221713|ref|YP_007105883.1|
Domain Number 1 Region: 89-300
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.72e-35
Family Phosphate binding protein-like 0.0013
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.63e-23
Family LysR-like transcriptional regulators 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221713|ref|YP_007105883.1|
Sequence length 325
Comment transcriptional regulator [Synechococcus sp. PCC 7502]
Sequence
MRLEQLQAFIAVAETGSFQKAAQKCNITQSTVSRQVQSLEQDLGVQLLHRHSQAKLTIAG
ERFVGRARKICNEWDTATQELADLIAGNQPELCVAAIPSVCAYQMSPVLQKFRFAYPDVQ
LRVTALGSDRALKVLKDGLIDIAVVMNNRFIAASPEIVVDSLYTETIMVLMAADHPLTKY
RAIPWQELGTYPHVVFKDGYATQRLVQDQFRLQQIKVDAALELNSLDAFRDIIRQSNLIA
LLTQSSLSGVEKDLSLAVRNTESPILTTEVVCVTTSDRLQIPPIRYFRQLVCELITTDQS
DQALTQTDLSLFNSPKYSQIYRSKK
Download sequence
Identical sequences K9SU53
WP_015168405.1.58188 gi|428221713|ref|YP_007105883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]