SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221725|ref|YP_007105895.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221725|ref|YP_007105895.1|
Domain Number 1 Region: 96-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000706
Family NfeD domain-like 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|428221725|ref|YP_007105895.1|
Domain Number - Region: 24-87
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0183
Family ABC transporter transmembrane region 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221725|ref|YP_007105895.1|
Sequence length 145
Comment membrane protease regulatory membrane protein [Synechococcus sp. PCC 7502]
Sequence
MLTAKVVWFALGITLLVLELLVPIPTLLLAGVLGIGALVVAAILLVGNIPIALQLLIWVL
ISGFLGWYSRRFIPKGLGRIRDADEAVTIAEILPGQAGRVKYEGNSWKARCDDPKTAIAI
NQKVYVLRRQGTTLIVMPEHWLQEH
Download sequence
Identical sequences K9SUE5
WP_015168417.1.58188 gi|428221725|ref|YP_007105895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]