SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221727|ref|YP_007105897.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221727|ref|YP_007105897.1|
Domain Number 1 Region: 5-234
Classification Level Classification E-value
Superfamily PHP domain-like 3.53e-34
Family PHP domain 0.01
Further Details:      
 
Domain Number 2 Region: 763-847
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000001
Family Intein (protein splicing domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221727|ref|YP_007105897.1|
Sequence length 860
Comment DNA-directed DNA polymerase III PolC [Synechococcus sp. PCC 7502]
Sequence
MSEFVGLHIHSEYSLLDGASQLPNLVDQALQLDMKAIALTDHGVMYGAIELIKTCRSKGI
KPIIGNEMYVILGDITKQEKKRKYHQIVLAKNNQGYKNLVKLTTISHLQGFQGKGIFARP
CISKEYLEQYKEGLIITSGCLAGEVPQAILQGHPDIARDTARWYKQIFKDDYYLEIQDHG
YPEDRIVNVEIVKIARELDIKIIATNDSHFVSCYDTDAHDALLCIQTGKLIEEEKRLRYS
GMEYLKSEAEMKLLFQDHLSDDIISEAIRNTAEVAAKVETYDVMSEPRAASYDVPLGYTA
ETYLEEVTWQGILERFQTKKRDDIPLNYQERLHFELGIMQQMGFSTYFLVVWDYIKYARD
RHIPVGPGRGSAAGSLVAFSLGITNIDPIHHGLLFERFLNPERKSMPDIDTDFCIDHRDE
LIKYVTQKYGEDRVAQIVTFNRLTSKAVLKDVGRVLNVPYSEADKMAKMIPVSRGKPAKL
KEMIGNDTPAPEFKERYEKDPKVFQWLDMAMRIEGVNKSSGVHAAGVVISPMPLDEIVPL
QRNADGAVITQYPMEDLESLGLLKMDFLGLRNLTTIQHTVDLINQQHKGQNFDINAIAPD
ANTVENQKTYEILAKGELEGIFQLESSGMKQIVRDLKPSNIDDISSILALYRPGPLDAGL
IPKFINRKHGRELMDYAHPDLEPILKETYSILVFQEQIMKIAQDLAGYSLGEADLLRRAM
GKKKPAEMEKQREKFLDGAAINGIKSKVATDLFEQMVLFAEYCLGYDTPVLTVEYGFMPI
GKIVEEKIQCHVYSVDQNGLVFTQAIAQWHNRGQQEVWEYNLDNGDIVRATKDHKFMTID
GQMLPINQIFEQGLELKVIA
Download sequence
Identical sequences K9ST36
WP_015168419.1.58188 gi|428221727|ref|YP_007105897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]