SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221728|ref|YP_007105898.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221728|ref|YP_007105898.1|
Domain Number 1 Region: 3-244
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.99e-89
Family Tryptophan biosynthesis enzymes 0.000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221728|ref|YP_007105898.1|
Sequence length 264
Comment tryptophan synthase subunit alpha [Synechococcus sp. PCC 7502]
Sequence
MISVSAKFELLRSHGQAALIPFITAGDPDLATTTEALKILDRSGADLIELGVPYSDPLAD
GPVIQAAATRALAKGVTLDQVLELVKNVSPELRSPIILFCYYNPILNLGIETFLQKIYAA
GARGLVVPDLPLEESHVLLEPAARIGIEVILLVAPTTPVERFEAIASQSQGFIYLVSSVG
VTGVRSQVSKKVQSILERLRTVTDKPIAVGFGISQPDQAKQVIEWNADGAIVGSAMVRLL
AEEGGLKAIEQLCIDLKRAIASVI
Download sequence
Identical sequences K9SU97
WP_015168420.1.58188 gi|428221728|ref|YP_007105898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]