SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221848|ref|YP_007106018.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221848|ref|YP_007106018.1|
Domain Number 1 Region: 441-617
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.95e-41
Family N-acetylmuramoyl-L-alanine amidase-like 0.00042
Further Details:      
 
Weak hits

Sequence:  gi|428221848|ref|YP_007106018.1|
Domain Number - Region: 363-411
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0251
Family GS domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221848|ref|YP_007106018.1|
Sequence length 624
Comment N-acetylmuramoyl-L-alanine amidase [Synechococcus sp. PCC 7502]
Sequence
MMILGKIIPRIKRLLKNLVLVLLVVVPFCLVISPSISQNNPKKLYVAYPSPNHQTQSDHI
FLIGTAAPDGDVRVNGMPIKRSRSGNFAPSFPLQLGLNTFKLRYKNQSLDLRVSRLPDFI
ELPKDLGFLPTSLMPNVNISRLPNEDICFEAIATPQANIQVKLSDFVIPLAKNEQLQLPP
NSAILTNTNLPYPSANGSFRGCTQFPESGNLGKPEFIATLGDRIISQKSGGNITILSPQK
IELAKVIVESGVARSGAGSDFSRLTPLPKGTVDRITARKGDWVRLSYGGWIDTKSVQITN
ASAVPNSLVRSFNTRKVTGWTELIIPLQIPVPITITQGDRNFILTLHNVTAQTDTNLVND
DPVVERIDWQQREPNKVEYTIRLKSTQQWGYKVRYEGTSLILSLRHPPQINSQLNSSVNS
QLNRQGNKFINSTDKRSLQNLKILLDPGHGSKEDLGARGGNGYPEKDVTLIVGKLLEQEL
LKKGAKVTLTRRGDDDIYPQTRAEMIEKQEPVIAISLHYNALPDQGDAENTKGIGTFWYH
AQSHSLAMFIHNYLVKDLNRPSYGVFWNNLALARPTVAPSVLLELGFMINPEELEWIINP
VEQKKLAKSLSDAIAQWVVTGESK
Download sequence
Identical sequences K9SUJ1
gi|428221848|ref|YP_007106018.1| WP_015168540.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]