SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221858|ref|YP_007106028.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221858|ref|YP_007106028.1|
Domain Number 1 Region: 330-522
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.32e-46
Family Ppx associated domain 0.0014
Further Details:      
 
Domain Number 2 Region: 137-316
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.02e-38
Family Ppx/GppA phosphatase 0.0024
Further Details:      
 
Domain Number 3 Region: 11-132
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.98e-35
Family Ppx/GppA phosphatase 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428221858|ref|YP_007106028.1|
Sequence length 527
Comment exopolyphosphatase [Synechococcus sp. PCC 7502]
Sequence
MTDVANERIITAIDVGTNSIHMVVVRIETTLPSFNVIATEKATVRLGERCAKTGMLTKEA
MERSLLALARCLEISRSFNAEAIISVATSAVREAPNGQEFIDTIEEKLGLTVDLISGQEE
ARRIYLGVLSALELNNQPHVIIDIGGGSTELILGNGHDPDYLSSTKVGAVRLSDLYITTD
PISDREFEKLQIYIRGMLERPTDELKLNLGNEPVRLIGTSGSIEAVAMIHAKQTLGTIPE
PLQGYEISIADVENVVLQLRQMTLAQRTALAKEKRGEIILAGAMILWEAMRLLNAGKLTI
CQRSLREGLIVNWMIEHGLIADRLQYQGSIRDRSVIKLAQKYNVDLDYGKQVARLALSLF
DQTQGILHKWGEQERDLLKTAAILHNSGCYISHSSHHKHSYYLIRNGELLGYTEAQIEAI
ANLARYHRRSEPKKKHETYRKLTNKRYRQFVDEINPLLRLAVALDRRQIGAVKGVKVKID
SKAKQFHLGIIPVEPNDPCTLELWSLDFKKEALEAKYQLTLVSHLLS
Download sequence
Identical sequences K9SUK3
gi|428221858|ref|YP_007106028.1| WP_015168550.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]