SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221967|ref|YP_007106137.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221967|ref|YP_007106137.1|
Domain Number 1 Region: 14-326
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221967|ref|YP_007106137.1|
Sequence length 355
Comment thioredoxin-disulfide reductase [Synechococcus sp. PCC 7502]
Sequence
MSYPIDVNIRTENSMPKPSEISNLVIIGSGPAGYTAAIYAGRARLNPIVFEGLKMGLPGG
QLMTTTGIENFPGFPTGIMGPELMRLMKAQAQNSGARLWMEDVISVDFKQRPFTVRSAER
ETLAHSIIIATGATAQRLHLPSEDQFWNKGISACAICDGGIPRFKDVELAVVGGGDTAAE
ESIFLTKYASKVHLLVRSDRLRASKVMQERVLNHPKIQVHWQTVPTDVYGNDWVQGLKLK
NTVSSVEQDLTVGGLFYAIGHKPNTALFIDAIELDPTGYIVTKGKSTATNVEGVYACGDV
QDHEYRQAISAAGTGCMAALEAERWLSGTGLLQEFLPVSTPEETIENDVIEFSLG
Download sequence
Identical sequences K9STQ5
gi|428221967|ref|YP_007106137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]