SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222234|ref|YP_007106404.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222234|ref|YP_007106404.1|
Domain Number 1 Region: 2-398
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-94
Family HD domain 0.000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222234|ref|YP_007106404.1|
Sequence length 403
Comment HD superfamily phosphohydrolase [Synechococcus sp. PCC 7502]
Sequence
MKSRTYHDPLHGAITLNGSDQVESLLIKLIDTPEFQRLRRIRQLDTANLTFHSGEGSRFT
HSLGVMALTRRAFDHLVDQYPSLKPHRCIVLVAALLHDLGHGAFSHAGEEIFGSQHEFWT
IKLIQESSIYDILYTFDPELPANLELVFTKKYPVTVISQLVSSQLDCDRLDYLQRDGYFT
GAQYGHLDLDRILLALNYDPDSQSLVITKKGLVAIEHYLTVRYFMYVQVYNHPKNLAARF
GLGKIFERARVVLATKSLPADKTVTAWLTQDLQTLDIKDYLAADDIVFMYHIHLWKNHED
QILADLCRRIQDRDLFKGSEITNLEDIEEYIQQWQQKLETIGFDPQYYCGIREALTKGYT
LYQQGIAVKTNEGLQEISQISSLVKTLVQPMRKKWLIHPKLAN
Download sequence
Identical sequences K9SWX9
gi|428222234|ref|YP_007106404.1| WP_015168926.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]