SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222333|ref|YP_007106503.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222333|ref|YP_007106503.1|
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily PUA domain-like 1.41e-44
Family Atu2648/PH1033-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222333|ref|YP_007106503.1|
Sequence length 138
Comment hypothetical protein Syn7502_02383 [Synechococcus sp. PCC 7502]
Sequence
MSYWLLKSEPHVYSYADLERDVQTIWDGVNNNLALKHIRTMAVGDLALIYHTGDERRAMG
IAEVISPPYIDPQLNDPKRAVVDIKAVRSLQQPVTLAQIKQDPYFAGFDLLRISRLSVVP
VSSEHWQRILALSDSVGK
Download sequence
Identical sequences K9SVY8
WP_015169023.1.58188 gi|428222333|ref|YP_007106503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]