SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222669|ref|YP_007106839.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222669|ref|YP_007106839.1|
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.28e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222669|ref|YP_007106839.1|
Sequence length 126
Comment anti-anti-sigma factor [Synechococcus sp. PCC 7502]
Sequence
MALQIHTASADPQTVCLTLNGELDTITSPDLDKAVQSHLACPEVKILILDLQKLSYVSSA
GLRIFAKTRKAVKSRGGKLFFTNLSPQVKKVFDIVKAVPLSEVFVNTQELDAYLAVMQSQ
AEDEEV
Download sequence
Identical sequences K9SY30
gi|428222669|ref|YP_007106839.1| WP_015169356.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]