SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222837|ref|YP_007107007.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222837|ref|YP_007107007.1|
Domain Number 1 Region: 48-332
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.16e-45
Family Pectate transeliminase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428222837|ref|YP_007107007.1|
Sequence length 538
Comment parallel beta-helix repeat (two copies) [Synechococcus sp. PCC 7502]
Sequence
MYKRSLNLIAVLTLASPSLFFLTSAYAASDRFSNNSSSNSPTNLSAKVAAAQTILYVAPT
GSDSANNGTQLAPFRSITAALAQAQPGVMVQIAAGSYTKDSGETFPLKIPSGVRLQGTDG
VIIAGGGSFFSATFTGQNVAMVAESNTQISGITLTNSNPRGYGLWLESAKNVTITNNTFT
GSTHDGIFLTGDANATITNNLFTKNRASGISAVGLSSGEISNNTFDDTGFGLSIGQKSSV
NVINNRIVNNVDGIVLTNATIPTLRGNFIANNNRNGLVILKDRNGQPSPNLGTVDSPGGN
IFEGNKLKDINNATGANMIAVGNKVDAKNVTGLVELIAVDSPAADGLTDIKGHWAEAYIV
ALAKQGVIGGFNDGTFKPDDPVTRAQFAAILSKAFASKATVKPSTTFKDVPENFWAFKAI
EDVQTKGFMSGFKNEVFLPSENIPRVQVLVALVSGWGLKGGSPDKLDKIFDDVSQIPDYA
INAIAAATVNKLVLNYPNNKMLEPKRNATRAEVAAFVYQTLVNRGQAVAIRSNYVVTQ
Download sequence
Identical sequences K9SW74
gi|428222837|ref|YP_007107007.1| WP_015169523.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]