SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222841|ref|YP_007107011.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222841|ref|YP_007107011.1|
Domain Number 1 Region: 75-147
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000257
Family 7-Fe ferredoxin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222841|ref|YP_007107011.1|
Sequence length 323
Comment Fe-S-cluster-containing hydrogenase subunit [Synechococcus sp. PCC 7502]
Sequence
MNYVASPLDSLRSHQWFKLICGASFQHLPAIRNLALVYTLAGNDCIDMAPDPAVIRAAKE
GIKVAQKLDKRASSPLIMVSFNAGEDPHFRKAKFSSDFCPSGCDRPCINICPTNAINLNG
VIENLCYGCGRCLPVCPPQIIYTQEQVYAPELIKYEEINAIEIHTHIGCTSEFKDLWEKL
RDLIPQLQVVAVSFPDGENLKEYLLELLEIMQPAPAHLIWQTDGRPMSGDIGDGTTRAAL
LLAQKVLNFNLPRGFVQLAGGTNASTVSKVKFLNIPISGIAYGSYARKLIADLLELGGDR
LEEYPELLKLALERAKSLVSEIK
Download sequence
Identical sequences K9SY84
gi|428222841|ref|YP_007107011.1| WP_015169527.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]