SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222907|ref|YP_007107077.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222907|ref|YP_007107077.1|
Domain Number 1 Region: 5-378
Classification Level Classification E-value
Superfamily Citrate synthase 3.66e-137
Family Citrate synthase 0.0000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222907|ref|YP_007107077.1|
Sequence length 378
Comment 2-methylcitrate synthase/citrate synthase II [Synechococcus sp. PCC 7502]
Sequence
MAIGEYKPGLEGVPATQSNISYVDGLVGLLEYRGIRIEDLCEHSNFLETSYLLIFGELPK
HQELEKFEHNIKHRRRIKYRIRDMLKCFPDDAHPMDVIQACVCALGMFYPLKDLRDIEYI
YGATIRLIAKIPTIIAAFHMMRQGNDPVPPRDDLSYAANFLYMLNEIEPDPLAAKVFDVC
LTLHAEHTVNASTFCALVTASTLNDPYVVLAAAVGTLGGPLHGGANEKVMLMLEEIGSVK
NVKAYLEEKISKKQKVPGFGHRIYKVKDPRAIILQKLVDQLFEQTGHDPYYDIALELEKQ
AADVFSEKGIFPNVDFYSGLVYKKLNIPVDLFTPVFAIARVPGWLAHWKEQMADNRLFRP
TQVYTGLHDVKYTPISDR
Download sequence
Identical sequences K9SWD9
gi|428222907|ref|YP_007107077.1| WP_015169593.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]