SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223140|ref|YP_007107310.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223140|ref|YP_007107310.1|
Domain Number 1 Region: 546-691
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000343
Family HD domain 0.039
Further Details:      
 
Weak hits

Sequence:  gi|428223140|ref|YP_007107310.1|
Domain Number - Region: 113-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0558
Family BAR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223140|ref|YP_007107310.1|
Sequence length 785
Comment hypothetical protein Syn7502_03310 [Synechococcus sp. PCC 7502]
Sequence
MGLSPNVITRVLCCPKREWLSRVTIGATFVCLTITVGSRFYWEPQLNIGEFAPTNIKSPK
TMEITDIEATRIAKERLKQEVPPVYRLDPSLSRRAMDHLEDLLTSGDRLLQLSGELPYTT
LLSYPAQIELRMLSEIEWQSLQKQANFTNPASTLTSNLKGSVKELAAHKSKLSASAYQNL
VDQITKARQKYQIARQELAQSPDLFRNRLLNLSKTEWESCKQSARKILEDILLAGLVPGL
PEESKQYRIRNSAYLPTDPIRRILVIDLINAVLIPNLQPDFMATREKISTVIESLQPQTV
TIREGEIIVRAGQEITAREFAFLDELGLTQRRPNIWAIVLTALAVSGTIIIFKLVIVNRY
LNNPKTINLKIRDLVSISLICTATATACVILSHTSIAFIPLATMGMILGSFYGSRLATVT
TILGSGLVAIAISPTLISYLPLVLGAVIGSGLTDRPNTRSRISINGIVVAVIQAGTYIAL
AVLIGNVAPIALGINALQYAASGLLASVVALGSIPYLEQLCYAITPIRLAELANLDRPLL
QKLVTEAPGTFQHTLFVANLAEAGARELGADTALVRTGTLYHDIGKTIRPEYFIENQMGQ
VNPHEILNDPWASADIIREHVTGGLRLAQKYHLPPLLQTFIPEHQGTIVISYFYFQAQQR
SPMVCEEHFRYSGPIPQSRETGIVMLADASEAALRSLGSDTTLEEATSVMMRIFKARWDQ
GQLLNSGLTLEELEKLAPVFIQVWRERNHGRIKYPDFAAKVDPSGASLPIKCEPEKVEKV
LTVHS
Download sequence
Identical sequences K9SYB7
gi|428223140|ref|YP_007107310.1| WP_015169826.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]