SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223176|ref|YP_007107346.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428223176|ref|YP_007107346.1|
Domain Number - Region: 77-154
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.0235
Family Proton glutamate symport protein 0.03
Further Details:      
 
Domain Number - Region: 13-49
Classification Level Classification E-value
Superfamily SIS domain 0.0556
Family double-SIS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428223176|ref|YP_007107346.1|
Sequence length 168
Comment hypothetical protein Syn7502_03356 [Synechococcus sp. PCC 7502]
Sequence
MSKLGKRPKALIAIVSYKSFTATLFATASLGIFLAAKNYEGLENLADSLALSGKRGIIAW
VLEKILNFEPRNLKFSAIALAVYSGVTAIEAVGLWYEKAWARWLVVGVVGISIPPEIFEL
WHGVSILKLVVFILNLGILWYLIREFPKEQPQEQSQGKSEKPNELAED
Download sequence
Identical sequences K9SZ61
gi|428223176|ref|YP_007107346.1| WP_015169862.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]