SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428221739|ref|YP_007105909.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428221739|ref|YP_007105909.1|
Domain Number 1 Region: 28-170
Classification Level Classification E-value
Superfamily GAF domain-like 1.18e-23
Family GAF domain 0.022
Further Details:      
 
Domain Number 2 Region: 232-438
Classification Level Classification E-value
Superfamily PP2C-like 0.000000201
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428221739|ref|YP_007105909.1|
Sequence length 440
Comment serine phosphatase RsbU, regulator of sigma subunit [Synechococcus sp. PCC 7502]
Sequence
MKAPIPDNEQARLAALYQYQILDTVAEVLFDDFTHLASQICGMPIALISLIDHDRQWFKS
KLGLESSETPRDQAFCAHAILNPDQPLIVEDATADVRFADNPLVTGDTNIRFYGGFPLVT
PDDFAIGTLCVIDQKPRTLMPEQEAALKMLSRQVISQLELRLKLQEIEERTKDLEQANGI
INCLNEKLAAENIRMGAELSVAQKIQMMILPKVGELELIPELDVAAYMEPAAEVGGDYYD
VIYHDGRVKIAIGDVTGHGLSSGIIMLMAQTAVRTLIGAGETNPVKFLGAVNQTLYDNAH
RMDSCKNMTLTILEYANQTLRVSGQHEEIIIVRRDGSLERLDTMDLGFPLGLELDIDAFI
GEAVIDLQPDDLVLLYTDGIPEATNSENQFYGLERMCAIAQKYHHLSATDVCKAVIKDVM
HFIGQQKIYDDITLIILKQR
Download sequence
Identical sequences K9SVJ5
gi|428221739|ref|YP_007105909.1| WP_015168431.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]