SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428222289|ref|YP_007106459.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428222289|ref|YP_007106459.1|
Domain Number 1 Region: 20-309
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-53
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 408-553
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.44e-38
Family Pentapeptide repeats 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428222289|ref|YP_007106459.1|
Sequence length 563
Comment serine/threonine protein kinase [Synechococcus sp. PCC 7502]
Sequence
MSYCVNPNCTRPDNPDKATVCLACGAALKLKGSFSAIRPLGRGGFGATYLAVDESLPGHP
PCVIKQLRPNTQSASVLKMARELFEREATTLGRIGNHPQIPRLLAYFEEAANFYLVQEYV
EGETLKQEFERKGNFKEIDIIKVLSEILPALGFMHQNGVIHRDIKPANIIRRKQDAQLVL
IDFGAVSTQTNRATAEEEEGGLLTSFAIGTPGFAPPEQMAMRPVYSSDIYATAMTCLYLM
TGRSPKDFPHDPYTGEINWRSEVNLSENMAAIFNKMLQISVSQRFRTAEEVIAAMGAKSA
PTITASRPPASNPVTPKRSTTSLRTSTTRGGSTQGAGKFSTQDLSGGSTTGKAITPRTQS
TRGWTKSPTGEDDSFTRTRDQTYIGKELGKELKGGRKVIVEYGHGKRNFANLDLSKASLA
GTNLSGIVMSRSKLVETDFCQSDLTHASFTGAIMTQVKLNGANLAQAKMQRAILTKADLG
GACLNQADLREANLQSAYMSKADLSGADLTGANLKGAYLSQANLRGTNLSGADLKGARIT
DEQIATAKTNWATVRPDGSKKIF
Download sequence
Identical sequences K9SX24
WP_015168979.1.58188 gi|428222289|ref|YP_007106459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]