SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479131785|ref|YP_005071745.1| from Arthrospira platensis NIES-39

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479131785|ref|YP_005071745.1|
Domain Number 1 Region: 9-298
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-52
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 416-529
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.19e-32
Family Pentapeptide repeats 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479131785|ref|YP_005071745.1|
Sequence length 543
Comment serine/threonine protein kinase [Arthrospira platensis NIES-39]
Sequence
MSYCTNPSCPNPENPNEAVKCQACGSRLRLRNRYLVVKPIGKGGFGATFLARDLSLPGYP
ACVVKQLRPSATSKRVLEMAQQLFQREAKTLGKIGDHPQIPRLLDYFVGKQQFYLVQEFV
DGFTLKQEVRANGAYNEQQTQEFLRDILPLLDYIHSQEVIHRDIKPANIIRRRQDNRLVL
IDFGAVKDKVSQATMMGTGETAFTNFAIGTSGFAPMEQMSLRPVYASDIYAVGMTCIYLL
TGKSPNALEHNPTTGEVYWREHTHVSNAFALVLEKMLAVSVYQRYQSAKDVLYALDHQDD
VEDDLSGNMSVQPIATEFTPDPPEEPTIYKDDQTSIMMTAPQREAKLIRERRERKKRREV
TEISVHKRPMGGGLSATQGAPITMLNSDTPSTQGTYIPSNWNEKNFRSAFSKGHRDFGDC
ELSGLNLSGGKWRGANFYQARLSNANFQNADLKDANFGRARLTEANFKNANLENAYLSTA
NLEKADLRGANLQGAYLTRANLRGANLCGANLRGCTVGDEQLALARTNWRTILPNGKRKF
CWW
Download sequence
Identical sequences D5A390
gi|479131785|ref|YP_005071745.1| WP_014276911.1.32502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]