SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386071404|ref|YP_005986300.1| from Propionibacterium acnes ATCC 11828

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386071404|ref|YP_005986300.1|
Domain Number 1 Region: 22-268
Classification Level Classification E-value
Superfamily Cgl1923-like 6.54e-63
Family Cgl1923-like 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386071404|ref|YP_005986300.1|
Sequence length 338
Comment hypothetical protein TIIST44_09145 [Propionibacterium acnes ATCC 11828]
Sequence
MDRQSNRFSWHPGIVGPDQEVSTLITLVQSFSDTGLVQARVRDAIFSQLPHHELGEFDID
LLLDHRDSRQPIIFDTDHFEGYERPRLVLHEVTDQLGQAFLVLEGPEPALGWESLVASLT
SLVDSMGIRLTVITDSIPIPTPHTRPAIVTRWASRPELILGSTSPFGRLQVPASFPVVLG
QRLGETNHAVIGLASHVPHYLADLDYPESARALVEALRGATGLALPINSLAVAANTVRAE
IDTQVNNSEELKAMLHALEEQYDSRVAQRELGTTQVAVPDAEDIGAEVEDFLRSIDEDDG
SSNDDPGTQGSGPRRSSDDTSDDDKPDYHPRRGGDLDN
Download sequence
Identical sequences D1YCF5 U7JIK9 U7MA56
gi|386071404|ref|YP_005986300.1| WP_002513618.1.1248 WP_002513618.1.22236 WP_002513618.1.25499 WP_002513618.1.2617 WP_002513618.1.34387 WP_002513618.1.3652 WP_002513618.1.42486 WP_002513618.1.4265 WP_002513618.1.43679 WP_002513618.1.46705 WP_002513618.1.47018 WP_002513618.1.47600 WP_002513618.1.4830 WP_002513618.1.65671 WP_002513618.1.6930 WP_002513618.1.77039 WP_002513618.1.78128 WP_002513618.1.79798 WP_002513618.1.85929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]