SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327401401|ref|YP_004342240.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327401401|ref|YP_004342240.1|
Domain Number 1 Region: 17-104,190-281
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.71e-17
Family Protein prenyltransferases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327401401|ref|YP_004342240.1|
Sequence length 291
Comment prenyltransferase/squalene oxidase [Archaeoglobus veneficus SNP6]
Sequence
MFPRAVYNSRICDIINVERLREFVLSRRNDDGGFTFCKQLPSTLPETFYAVYILTSIGDE
VPDKEKLVEFLRNSIRTEPYSIFYTLNSLNLLSEKLLDVSDLLFNRLEKITKVVPREFGS
EIGTTATYSFDMPNVLKGVYILTSSLRLLGKEIPDEVKDFIMKFRKNGGFGIASPNLQET
YYCVSVLGNVIERANSVVSFVREHECQGGGFTKVPNGYPPYLEDTYYAVSCFCVLGYDYA
SEKTARYISALQNPDGGFRRSIHGGISSLEYTYYAVASLVLPEESIGNLRE
Download sequence
Identical sequences F2KPC1
WP_013684186.1.73781 gi|327401401|ref|YP_004342240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]