SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327401688|ref|YP_004342527.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327401688|ref|YP_004342527.1|
Domain Number 1 Region: 3-26
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000319
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327401688|ref|YP_004342527.1|
Sequence length 58
Comment hypothetical protein Arcve_1816 [Archaeoglobus veneficus SNP6]
Sequence
MPECPHCGKWFRSNKGLKQHITKVHTVDTPVGRVFDPSTLDPIGAMERRAKRAKRRKW
Download sequence
Identical sequences F2KR06
WP_013684468.1.73781 gi|327401688|ref|YP_004342527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]