SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327401978|ref|YP_004342817.1| from Archaeoglobus veneficus SNP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327401978|ref|YP_004342817.1|
Domain Number 1 Region: 30-297
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.75e-20
Family Terpene synthases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327401978|ref|YP_004342817.1|
Sequence length 400
Comment hypothetical protein Arcve_2113 [Archaeoglobus veneficus SNP6]
Sequence
MHEDVDEIFTELMKEIRKLEKSRRISVEHEELLKKAVGWLKDHQHPEGYWGYESVADTCL
VLLALSMYEIRKNEEWLIKGKYPGGIKRSVEWLKKTQNIDNWENNLWDTSICLQALYRLG
VQDEWVIKSAEWVRNKCEREPKKFPVHHLAQALNVLNLAGYDECAKKITEIVISKVEERI
ENKKGDEYLYDPYVTGQILDALVRSGVPVTHKVLRACENDLRRFLEEKKVKGISEGAFQD
VTMALLGLASFLGGGDDELVNAVVAEIFKSPERYKKDGCWYHDAKKTAFALLGLSRIKEV
RKIDEFPYKIYTLIARYHEKIRDCIAELEKTYEKRIKRGYLLLTLIYILLMASVFAIIEY
GVESPISQLLLGSLIIPVLFQISPYFKKYILPYLKRGGKK
Download sequence
Identical sequences F2KSN2
gi|327401978|ref|YP_004342817.1| WP_013684753.1.73781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]