SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|365965032|ref|YP_004946597.1| from Propionibacterium acnes TypeIA2 P.acn17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|365965032|ref|YP_004946597.1|
Domain Number 1 Region: 23-268
Classification Level Classification E-value
Superfamily Cgl1923-like 8.37e-63
Family Cgl1923-like 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|365965032|ref|YP_004946597.1|
Sequence length 338
Comment hypothetical protein TIA2EST22_05455 [Propionibacterium acnes TypeIA2 P.acn17]
Sequence
MDRQSNRFSWHPGIVGPDQEVSALITLVQSFSDTGLVQARVRDAILSQLPHHELGEFDID
LLLDHRDSRQPIIFDTDHFEGYERPRLVLHEVTDQLGQAFLVLEGPEPALGWESLVSSLT
SLVDSMGIRLTVITDSIPIPTPHTRPAIVTRWASRPELILGSTSPFGRLQVPASFPVVLG
QRLGETNHAVIGLASHVPHYLADLDYPESARALVEALRGATGLALPINSLAVAANTVRAE
IDTQVNNSEELKAMLHALEEQYDSRVAQRELGTTQVAVPDAEDIGAEVEDFLRSIDEDDG
PSNDDPDTQGSGPRRSSDDTSDDDKPDYHPRRGGDLDN
Download sequence
Identical sequences A0A0E1YFM9 A0A1J4X8I0 A0A1N4Y6K3 A0A2B7IGW7 D4HDQ7 F1UGS3 Q6A8S0 W4TPY3
gi|386024043|ref|YP_005942348.1| gi|365962791|ref|YP_004944357.1| gi|50842577|ref|YP_055804.1| gi|387503471|ref|YP_005944700.1| gi|482890235|ref|YP_007887398.1| gi|365965032|ref|YP_004946597.1| 267747.PPA1099 WP_002514993.1.101196 WP_002514993.1.102089 WP_002514993.1.102131 WP_002514993.1.15006 WP_002514993.1.1505 WP_002514993.1.17969 WP_002514993.1.18145 WP_002514993.1.18363 WP_002514993.1.20232 WP_002514993.1.22959 WP_002514993.1.23000 WP_002514993.1.2563 WP_002514993.1.26956 WP_002514993.1.27635 WP_002514993.1.28533 WP_002514993.1.2928 WP_002514993.1.29382 WP_002514993.1.29850 WP_002514993.1.30003 WP_002514993.1.31063 WP_002514993.1.31624 WP_002514993.1.3171 WP_002514993.1.31800 WP_002514993.1.32488 WP_002514993.1.33260 WP_002514993.1.3428 WP_002514993.1.34331 WP_002514993.1.36413 WP_002514993.1.37742 WP_002514993.1.38538 WP_002514993.1.40065 WP_002514993.1.41101 WP_002514993.1.41264 WP_002514993.1.41273 WP_002514993.1.41331 WP_002514993.1.42227 WP_002514993.1.43449 WP_002514993.1.43585 WP_002514993.1.43983 WP_002514993.1.44257 WP_002514993.1.45324 WP_002514993.1.48202 WP_002514993.1.48475 WP_002514993.1.49524 WP_002514993.1.50101 WP_002514993.1.50375 WP_002514993.1.50378 WP_002514993.1.50533 WP_002514993.1.51523 WP_002514993.1.53219 WP_002514993.1.54292 WP_002514993.1.5458 WP_002514993.1.56110 WP_002514993.1.56441 WP_002514993.1.56454 WP_002514993.1.56826 WP_002514993.1.57145 WP_002514993.1.57563 WP_002514993.1.58125 WP_002514993.1.59251 WP_002514993.1.59962 WP_002514993.1.60466 WP_002514993.1.60649 WP_002514993.1.60667 WP_002514993.1.61734 WP_002514993.1.66193 WP_002514993.1.66916 WP_002514993.1.67054 WP_002514993.1.67213 WP_002514993.1.67247 WP_002514993.1.69974 WP_002514993.1.70135 WP_002514993.1.70496 WP_002514993.1.7197 WP_002514993.1.72191 WP_002514993.1.73086 WP_002514993.1.73414 WP_002514993.1.74417 WP_002514993.1.74746 WP_002514993.1.74916 WP_002514993.1.7599 WP_002514993.1.76554 WP_002514993.1.767 WP_002514993.1.76841 WP_002514993.1.7771 WP_002514993.1.80166 WP_002514993.1.80187 WP_002514993.1.81031 WP_002514993.1.81478 WP_002514993.1.821 WP_002514993.1.82350 WP_002514993.1.83430 WP_002514993.1.86359 WP_002514993.1.87452 WP_002514993.1.89010 WP_002514993.1.90730 WP_002514993.1.90935 WP_002514993.1.91146 WP_002514993.1.91610 WP_002514993.1.92292 WP_002514993.1.94227 WP_002514993.1.97417 WP_002514993.1.97839 WP_002514993.1.98061 WP_002514993.1.98214 WP_002514993.1.99435 gi|295130658|ref|YP_003581321.1| gi|365973966|ref|YP_004955525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]