SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_020980 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PBANKA_020980
Domain Number - Region: 122-164
Classification Level Classification E-value
Superfamily RING/U-box 0.00202
Family RING finger domain, C3HC4 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_020980
Sequence length 742
Comment PBANKA_020980 conserved Plasmodium protein, unknown function 846882:849110 forward MW:87537
Sequence
MYIQYRLFSEHSLWRVLEINKNENYILVSELKNIIRKQSNINYNNKIDIYFSLYQNEDNE
EDINKKSRNISKEIKYLDVDDKIYNGNKILVHRDVKKKNTVHDITHIAKKEIILDVEEKQ
KVNLPNEFLCKICNYMLIESYIIVCNNNCGYSVCKSCILFYIFSCIIKEDEKKKNYIDLS
LIKNDDNIIKCPICKGVLKYCIINKKMELTLKKLQDERNDIDSFNFIIQERNNKFGKIIE
KMKIQNFDYSSIENRSNDGTNIYTLFNSHIFKTIEEKYICSTNNNNKANEQIQIEEKSVL
NHFLYLMDSNKLNSIKEYQMIYIDFDSCIFDTIQKMNIRNISEHINGNQLLQNILHPYEV
DNNSIPNIVCDSGIVKKIDNERLDNIKYEKNENMNSNAYNIPNIDQNNAQEEIGEKLYIK
NKTYIIPISFVGGETSYSLIGVFYISDLVTSFNNGNTKDRNEKHVNNKIENFMMKWHAND
SVGNHINKENIMNKLKNGDIYKVEYVNKYEKTCFIPVRKQPLYNIINTKRNKTKKKTNIE
IVLELKKFMEIVLTVDNYIRYGSRPNNYEIKKVVTSGGDDISVDTGMGGGINIPFNNMDE
NEKKNMNVQKNKEIQDISYIIGNNQDINSQIIYEGTLQSNYPSENIYILTKHTEFQEIYE
ILYSTKTMPVSIQNNFNINNPYADYCAILPFLTKEEFLFFRKLQRIYKEKYLKKLYKHVK
ENNLNINIFSNAINSIFFSTIR
Download sequence
Identical sequences A0A077X8L3 A0A113QND2
PBANKA_020980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]