SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_041360 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_041360
Domain Number 1 Region: 35-87
Classification Level Classification E-value
Superfamily RING/U-box 0.00003
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_041360
Sequence length 265
Comment PBANKA_041360 conserved Plasmodium protein, unknown function 2226045:2226842 reverse MW:31311
Sequence
MNTFPSNATNYRNRTLNSSGKNTNINYKINSYINKNWIFCPACSLPFNTKLRINPCYHIV
CGKCYEISLQKNQSCIICNSEINDVDFIFQNDNIYICPYDFCKKGYLNLKSYNYHIYFKH
EFLKEHGQDYELNCHKENNNLFPMNNEFVKDYFVNYVNATELENKTATDFANNLNNIKNN
SFLIKNNTTNKTSSENIQTNINNKMNMPFINSKVNVPDNWNFTSMPFRSNFNLYSNEKYN
TNNVNTKKNNEPQEEDDYDNLEDLM
Download sequence
Identical sequences A0A077X782 A0A1C6WS06 Q4YCH7
PBANKA_041360 gi|68076437|ref|XP_680138.1| XP_680138.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]