SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_041640 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_041640
Domain Number 1 Region: 121-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000202
Family Thioltransferase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_041640
Sequence length 270
Comment PBANKA_041640 conserved Plasmodium protein, unknown function 2349652:2350464 forward MW:32471
Sequence
MYVKMQNLRKVLKLNNGNIKIGNIGGLYRNYNSSKTLCANPDIKHIHNMYKLNDIYYNNL
KIINNYDEYYNLVIKNEYFKDYSKMRNTFQDDQKGFNNNTYMSDNKSEDSRNNTILNNIE
DMNSDNSSKNIISSNDLQVLYFGSYENNTSIILFEKFKDIIEKNRKLQFIFLDVNVCPQG
SYNCDVRYVPCVCLIYKNHIYRKKLEINYEKPIDENYLKEFLNEVQKNIDFFHSYNNKYI
YSIKKQSNYLNTKYIDIDNQNIHKENWNTF
Download sequence
Identical sequences A0A077X6L2 A0A122HWE9
PBANKA_041640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]