SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_051970 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_051970
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-36
Family Phosducin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_051970
Sequence length 213
Comment PBANKA_051970 conserved Plasmodium protein, unknown function 3164732:3166357 reverse MW:24947
Sequence
MNPKNKLIDICTSLTLEQAKEGITKECKLVKEQNKYPKDILSKNSLDQNVNAQNSNETDE
NSDEEEIRKWREKRLIQLKKRQELKKDGVYIDVIEKDFIPTVVKNACVVCHFYDNNFKRC
HILHTHLIKLANIHLATKFIKVEAKNCLFFMNKLSIKALPSLCLFIDGVLIKTCIGFEDF
GNKDEFKTKDLEVFLFKKNLIRNTEYNENDEED
Download sequence
Identical sequences A0A077X9S3 A0A0Y9UZ97
PBANKA_051970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]