SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_060360 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PBANKA_060360
Domain Number - Region: 15-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.076
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_060360
Sequence length 120
Comment PBANKA_060360 conserved Plasmodium protein, unknown function 3512653:3513582 forward MW:14325
Sequence
MRYRLFPPLTFLSYLKKMHVYYSPARIEKADVARRLIIFASSQKIKQKYPLLTVTWELLA
YDNPPMIEVEYLNGEKEKINIEYFSDRQKKEIIDKWKYTASLEAFPEVLAPTIEKPQNSF
Download sequence
Identical sequences A0A077X8B0 A0A113R5T9
PBANKA_060360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]