SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_070280 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_070280
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.58e-32
Family PDI-like 0.0013
Further Details:      
 
Domain Number 2 Region: 319-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.74e-30
Family PDI-like 0.0013
Further Details:      
 
Domain Number 3 Region: 223-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.6e-18
Family PDI-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_070280
Sequence length 482
Comment PBANKA_070280 protein disulfide isomerase 4421394:4422951 forward MW:55411
Sequence
MNTKYISFFLFIIPFIFKNYVRSHEDLFNEHITSIHDGELNNFITKNDIVLVMFYAPWCG
HCKRLIPEYNEAAIMLSEKKSEIKLASVDATVERGLSQEYGITGYPTMILFNKKNRINYG
GGRTAQTIVDWILQMTGPVSTEITGNIEDVLKESNINVAFYMEYISEDNELFKKFNEVGD
KNREIAKYFIKKNDKHNKIYCYRKDEKTVEYDEKTPLNDFVAIESFPLFGEINTENYRFY
AESPKELVWICATIEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKASLGINEFPG
LAYQSSEGRYLLANPQQSLKNHKDIISFFKDVEAGKIEKSLKSEPIPEEDKNAAVKVVVG
NSFTDVVLNSGKDVLIEIYAPWCGHCKKLEPIYEELGRKLKKYDHIIVAKMDGTLNETSL
KEFEWSGFPTIFFVKAGSKIPLPYEGERTLKGFVDFLNKHSTKTPITIDDVSQSYEGSSE
EL
Download sequence
Identical sequences A0A077XA75 Q2XQR4 Q4Z2V7
gi|68070467|ref|XP_677145.1| XP_677145.1.11252 PBANKA_070280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]