SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_080620 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_080620
Domain Number 1 Region: 13-104
Classification Level Classification E-value
Superfamily RING/U-box 9.24e-34
Family RING finger domain, C3HC4 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_080620
Sequence length 107
Comment PBANKA_080620 ubiquitin protein ligase, putative 5422542:5422865 forward MW:12527
Sequence
MINNIRSEEKEIFKVHKWSAVAAWSWDISVDNCAICRNHIMDLCIECQAKLNDHINDKDK
KIDKENCTVAWGVCNHAFHLHCISRWIKARQVCPLDNTTWEFQKATT
Download sequence
Identical sequences A0A077XBU2 A0A0Y9VY84
PBANKA_080620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]