SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_081710 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_081710
Domain Number 1 Region: 67-171
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-17
Family Thioltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_081710
Sequence length 178
Comment PBANKA_081710 thioredoxin reductase 3, putative 5822031:5823096 forward MW:20697
Sequence
MALICIGSVCFSLFHVGILILVIINFFYSHIKKILPQCFNPNNDQINQIQNVLQLKKKNR
EYGKSTFIKLSKNSNIKDIFQSSKCMSIVLKFGATWCKPCVNIEDYFRNQTNYYVVTLVS
IDVDIHKALKKEHNINGLPTFEFYFFLNNEWILAERIEGANEKELEKAFQAYSLPILD
Download sequence
Identical sequences A0A077XC71 A0A0Y9W3C7
PBANKA_081710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]