SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_083550 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_083550
Domain Number 1 Region: 334-432
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000388
Family UBX domain 0.021
Further Details:      
 
Domain Number 2 Region: 127-257
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000047
Family Thioltransferase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_083550
Sequence length 442
Comment PBANKA_083550 conserved Plasmodium protein, unknown function 6435562:6437134 forward MW:52128
Sequence
MDNEIKLFMEMTKLSDKDEAKRLVEMCNGNLEDNIVKYLKNGELESLSQGNELKKRKGNE
DNSNKTENIVNDKVYKKSENNIVKSHFFEILNNIRGVICPLFRNIYNMITSCFNLISSYI
LNSCNKNSFTVYYEEKYGKIHVNFFNGNLKDAINKSKKEEKLLLVYLHIDNEESEYFCKH
IYTNIEIIPFFENNCILYAQDISKYPFIELHDKINIYMFPQISILLTYTSNIKELSVIYG
RPSATDIIQSIIECIEKAAIEKNKMERNRSMVSNVNETVYRDRLLREEQDREYQEALKKD
KEILEKKKKKENEKLLKIEKKKNYIKDIKNKRNEKSKKFPLNIEPNDKVTKILLRLPNGL
KVQNNFSSNHTLRDIYDWAECCDILEVDKTKKQNMNIPCKFDLICGHTKYVLKNSTNLIK
EFDLYPNAVLNMKSLDSSDNEE
Download sequence
Identical sequences A0A077XCP5 A0A113RJI0
PBANKA_083550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]