SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_091430 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_091430
Domain Number 1 Region: 114-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-29
Family PDI-like 0.0079
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.94e-16
Family PDI-like 0.029
Further Details:      
 
Domain Number 3 Region: 286-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000761
Family KaiB-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_091430
Sequence length 423
Comment PBANKA_091430 protein disulfide isomerase related protein, putative 7076324:7077595 forward MW:49213
Sequence
MKLYGKIHFILPVLYLFAKYASSLYTNVKEIKTVESLNEFDELINSQKKCLVQFYATWCR
VSRGFSNDFINIAKTVKDDILVIAIKNEDIINKYKIKTYPNIQLFFTNDKKEKHIEQFDG
NYKIKDVVSFIYDNIKNYRLKELNIDVGKKDNSNKKNKKNKNSGKVIVLNDSNFDQNVLK
NDDNVWFVFFYAPWCGHSKPIHPMFDELAKKTSHLKNARIAKIDATVEQRTAQTYEIKHY
PSFRLFPSGNKKPHTAIDYNESRTVNDLYQFFLKYYKEKKEIIQLTSRNVFDEHCENDVC
LLAILPSKEDIEPSSLKSYIQILTSVIKDVNHLPVTLMWTHAGDQLDIVQKLNLTFGFPT
VIAISFSKNVYSILKGNYSEQSIKNFVIQMMTGKSSVDNLVPFNVNNVPKVDLNNMNEYN
SEL
Download sequence
Identical sequences A0A077XDC1 A0A113RMG4 Q4YR30
PBANKA_091430 XP_678364.1.11252 gi|68072899|ref|XP_678364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]