SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_092090 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_092090
Domain Number 1 Region: 22-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.11e-19
Family PDI-like 0.02
Further Details:      
 
Domain Number 2 Region: 233-342
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000991
Family PDI-like 0.065
Further Details:      
 
Weak hits

Sequence:  PBANKA_092090
Domain Number - Region: 164-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000193
Family PDI-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_092090
Sequence length 429
Comment PBANKA_092090 conserved Plasmodium protein, unknown function 7299790:7302729 reverse MW:51471
Sequence
MINIFFVYIFLYFFACNINAKYFYPQNEILKVTSNNIQSVFELNEYWLIKFYAPHCVHCK
RIWNKITNLRYDVQNENKKKIYFGEVNCDNTNERAICDKYKVSNVPQLKLFKGNELISTF
SNDVNNVSILKKWLYYATTPIFHDIYSEEELNNYKTNDSLFLTCSENLNDNLIKVAKLYF
EENYFLNIKNQELCTKLSIKNTSLHVQGAHDNFVSNINQMNFEELKHFVNKNRFPLVSKI
DHYSFFNIRSSGNNLILLLIDFQNEPDKYIFQFTQFAKRHINLKEYIFSYIDGKYYEENL
ELYGADSNKFPQIIVFSKNPREYYFEDYFDIDHIQNIIDDIENKRIKPKVEEFTKMAILM
AKIKKQINYIIDKSFRTDFKSFIGFICALIMIAFTLVLVFHTMYSFVKKPESQYKMDAKK
KIDKRFETR
Download sequence
Identical sequences A0A077XBU6 A0A0Y9WML2
PBANKA_092090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]