SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_092410 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_092410
Domain Number 1 Region: 116-224
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-24
Family UAS domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_092410
Sequence length 340
Comment PBANKA_092410 conserved Plasmodium protein, unknown function 7396892:7398044 forward MW:39973
Sequence
MCNGNSDSAIKLYYEINGDTSLRNENNQVMNEINYEDQANIEGKLNDVIKNESKEKEKEK
RKKENNDNDVEYIREPDKHFSQALINDMDNLNFVHFNDRNKNIKKTKIELGDTIGKLFSL
PEFLICPLSLEEVRKKSKIENKYIIVNIQNSEFESLKLNRDIWNNETIQEIIKDSFIFWQ
RDEHDQDAIIFMNTYKITNLPCICVLCKRTGRKLKIWNAKTFDDPICAQSQLYELIEAVE
TKPNNNYSSINDKNKNVELKNKLVKTDYEKVNNSLSNNINKTCKTEKDITNCVTYSQPDI
SQKNTGIVKINTTEQLKEYSTINNELLELHKFRMQRTQRK
Download sequence
Identical sequences PBANKA_092410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]