SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_093830 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_093830
Domain Number 1 Region: 29-127
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-30
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 181-293
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.54e-22
Family Thioltransferase 0.026
Further Details:      
 
Weak hits

Sequence:  PBANKA_093830
Domain Number - Region: 418-532
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00104
Family Thioltransferase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_093830
Sequence length 553
Comment PBANKA_093830 heat shock protein, putative 7907792:7909453 forward MW:63468
Sequence
MNSTNEKKRKRITNLNSIIWLLLSFFLTCAEGVDYYKRLGLKRNATKDDISKAYRKLAKE
YHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGENYAEASQGFGGGPGGPGGGGPGG
FGNGFPFDQDVVNEIFRQFSGGGRGGNSGGNFHFKFSSGGNKGYNSGPRYGGSHPFEEEY
YEDIYKNEVLKINSKNSNSIIDDINYSLLINFYSSSSSECISFKKIYLKLSKKYDGYINF
AVINCDEEKALCKKYKVRSLPHMILIKKNKTYETLYGSKTEDNVKNFINNNIPYSFTEIK
NKKNLDKFLTKSADIPKVLFFISHKDNIIMLKVLSMEFEKRLNIGIVYDTNYTIMKIFKK
RNIKTPSILLIEDIDTLEGDLTHLKTVDFNILSLKLSHIVAQHRLKNNLYGHITSYQELT
KKKYDSGHCNEKDSQICFFILKLLNQNYKSLDEDIKRVATKFSNDPLKILYINIFNQPYI
LDSFGLTNECKHPNCLILVAFRPKRQRFRVFDGEVNYNNVLNFIDNVVSGGLSINQNIKK
GLNFLKNSYYDEL
Download sequence
Identical sequences A0A077XE56 A0A0Y9WTK5
PBANKA_093830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]