SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_102400 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_102400
Domain Number 1 Region: 202-281
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000106
Family Glutathione peroxidase-like 0.023
Further Details:      
 
Weak hits

Sequence:  PBANKA_102400
Domain Number - Region: 459-540
Classification Level Classification E-value
Superfamily Translin 0.0549
Family Translin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_102400
Sequence length 628
Comment PBANKA_102400 conserved Plasmodium protein, unknown function 9054513:9056696 forward MW:74168
Sequence
MIKILFFFIFQVFIISAINVNSIKHKYFSAISHAGLPLGLQTNKQRKFSYIDLRKDKRED
SKGNLLSVNKNSKNNSSLQNVSFLGFMGITGLSVPIIYASLMVYNKLINNNKNLSDSEKI
LGKYLYKHDNSIVAKNIYDNDKSFNIFYIITNIYYNLLAYVNFYINAKKIKTKKNVNDYT
ILFFHSYNVDKFLQSRNIKTYVDRLKETYKLINKNNNVNIIYVPLDNKILFNIKHFGLMN
NWYSVIFNDKQQVLKLIKNYNIMNIPTMVLLDKNMNVINDNINYLLLYNSKDFPYKNINS
LTYINNIYDKNNNQHNFKKLDSDYVIFYFNNDKENKEDIETLIKIKNQLSKNNIKLDIIF
IKDIQRKPEKTNFSQGNSSDVENNNKTNDEIKNEENYGENEQKKLENSEENEKKSYMNEI
YHLGKEENNSIYKLLLYDTFDVTFKPISILVNKKGKILNKYINVNKKNNDISDFILNNHK
SLKEKVNEHNYIYKYDNISNLNNLNVFAPIFILFLDKLDFNLLNTYNELIEIYNQNRKGK
KINFYLVLNDDKKYEALKNLCSVNNTTQVAILDLFNQKLFKESVNNINIIQNVDGKYNIN
KDNFFKFLNNFYSDDLYSSPIVLTKPSL
Download sequence
Identical sequences A0A077YGR0 A0A113RV16
PBANKA_102400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]