SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_111190 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_111190
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000377
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_111190
Sequence length 260
Comment MAT1 CDK-activating kinase assembly factor, putative 10172531:10173313 reverse MW:30988
Sequence
MDEYKCSLCLDDIYINTEKKLFLFDICKHKICGECLENHLNKHNKQHCPRCKIAITKKNV
VPFDIEEKIYSNQKNIRSKLTEIFNKKRHNFQNTPLYNNYLEKIEDIIFMLTNECDEKKR
KIIEAYIKKYEKENIKLIEENNSLIYENEKKKIHEIVKEEGNLYEIIKQRPIVNKLNNEA
YVHSLVKENPKLFNEIKVTNISESQPQPLNPAIRNDTDIPIRKFVSEEEIKKSDYSGGYD
ISIVFKRCDQEFNSTIYLNI
Download sequence
Identical sequences A0A077XFP2 A0A0Y9XNT9 Q4Z439
gi|68066068|ref|XP_675017.1| PBANKA_111190 XP_675017.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]