SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_112340 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_112340
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily RING/U-box 3.03e-25
Family RING finger domain, C3HC4 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_112340
Sequence length 86
Comment PBANKA_112340 anaphase-promoting complex subunit, putative 10561806:10562066 forward MW:9967
Sequence
MRKVTVKKIHAVARWKWIGSSIDNICAICNNSLENTCTICIRPGDSCPPAFGKCGHHFHL
HCMEKWIRQNKLTCPCCRADWYYKTQ
Download sequence
Identical sequences A0A077XFX2 A0A113S1W0 Q4Z5X3
PBANKA_112340 gi|68071237|ref|XP_677532.1| XP_677532.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]