SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_120480 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_120480
Domain Number 1 Region: 19-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.86e-38
Family Phosducin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_120480
Sequence length 193
Comment PBANKA_120480 thioredoxin, putative 11622124:11622705 reverse MW:22938
Sequence
MNNNITKNIEGQILEALKDKEKEIDHEIKKYETLERKIYDDNDEELENIKNKRLQELKNR
HNENRRLLSMGHGVYKEILSEKEFFDICKNSTNVCCHFYRNTTWRCEYLDSKLINLSKKF
IHINFIKINAEKSPFLCDRLKIWCIPTLMLIQNGKTEHSIIGFDELGGDNFSEQALINIL
KKWKLINQTDEDG
Download sequence
Identical sequences A0A077XE58 A0A113S7H1 Q4YWA8
PBANKA_120480 gi|68065228|ref|XP_674598.1| XP_674598.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]