SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_121210 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_121210
Domain Number 1 Region: 55-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000612
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_121210
Sequence length 194
Comment PBANKA_121210 conserved Plasmodium protein, unknown function 11878196:11879377 forward MW:23389
Sequence
MKISILVLFLIFIKNIICEIRELSFHEFERMLTKNYHQNKNYILENKINYKKSHTIKDYL
YLNTDNDFVLYLYAKWNADSNNLITVFREVARIIEEKNLKIPFYTFNVDNAKEFCNLINV
TSLPLILYVSSVHKKKYDSLLQKIVNSSKDIKIGNAFRYSGDMYCYDYIVDWVEVHHYFA
KALLFMKRIFMKRI
Download sequence
Identical sequences A0A077XEH4 A0A0Y9YE82 Q4YNK5
PBANKA_121210 XP_675332.1.11252 gi|68066717|ref|XP_675332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]