SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_121940 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_121940
Domain Number 1 Region: 107-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.96e-44
Family Glutathione peroxidase-like 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_121940
Sequence length 286
Comment PBANKA_121940 Cg3 protein, putative 12165955:12166815 reverse MW:33277
Sequence
MNKILLRNVNKVKRGGAFCKSCINYNLNLNKYENKIIFETKLNFSTNKKNAENPLKKKKS
IFLTWKCFVFNLGLCIPTLYLYKLKCDKKNNGKNHIGKTRVENIGKPLIGGNFTLIDYNG
NIVTNQTFKGKYCLIYFGFSYCPDICPQELEKQTIVFEKISKKYGDILTPIFITVDPNRD
TVAQINYYCKSFNPKLIGLTGTKDLIKHVAKLFRVYYNEHVTEMSNVNKTVNDQNKYNYL
IDHSIIHYLLDTEGKFVDFFGKNCTINEMVERISQYLDEHIAIQKK
Download sequence
Identical sequences A0A077XJ16 A0A0Y9YIB0
PBANKA_121940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]