SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_122800 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_122800
Domain Number 1 Region: 4-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.59e-62
Family Glutathione peroxidase-like 0.00000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PBANKA_122800
Sequence length 220
Comment PBANKA_122800 1-cys peroxiredoxin, putative 12493074:12493736 reverse MW:25394
Sequence
MGYHLGAKFPNFTAKASGINGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEE
FLKLNCKLIGFSCNSKESHDQWIEDIKHYGKLNKWEIPIVCDESRELANKLKIMDEQEKD
INGLPLTCRCLFFISPEKTIKATILYPATTGRNAQEILRVLKSLQLTYKIPVATPVNWNE
SDKCCIIPTLQDDEISKYFKNEVTQVEMPSKKKYLRFVDL
Download sequence
Identical sequences A0A077XH98 A0A0Y9YMG8 Q4YVS0
XP_677992.1.11252 PBANKA_122800 gi|68072157|ref|XP_677992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]