SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_123120 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_123120
Domain Number 1 Region: 10-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.63e-34
Family Phosducin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PBANKA_123120
Sequence length 311
Comment PBANKA_123120 conserved Plasmodium protein, unknown function 12627794:12628729 reverse MW:36660
Sequence
MSTTNPTIETTEWDDLQRKFGNIPPLEKEIKEEEIYLKNIDRIENEDIFENKNLEELKIL
EEENQDDEYLKIINKYKMDRINEINKNRLLNIYGEVYEISKETFITEINEASKKNPLNNT
NKNEEINEINEKKKTGTFVVLHLYSDNVISCKILNQILKELANKHKYIKFTKGVYNKIIE
NYPENKLPTILIYYNGSCIHQICNLINNIKGGLNNLNLKSFENFLKKYNILKQQKCTNST
SSDENTDSNDSDNYTKKQKKNIKTQKQYMSFNLFSNKNKNEEYDSSSNESEMKSKGYSSS
LMDRKINLSRL
Download sequence
Identical sequences A0A077XHF9 A0A0Y9YP38
PBANKA_123120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]