SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PBANKA_124430 from Plasmodium berghei ANKA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PBANKA_124430
Domain Number 1 Region: 216-282
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-16
Family RING finger domain, C3HC4 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PBANKA_124430
Sequence length 284
Comment PBANKA_124430 zinc finger protein, putative 13096070:13097341 reverse MW:34076
Sequence
MVEEGNTTHTYFGRIYKNVSNYVNSYMTASDQEMQNNTDPIMDIITTAPSDSLYFIERIN
LISAIISISTSFPYLTYLFIYWNDCSCNDILRWWIVINSILQLLQAPIRFFLYLLLRKYK
LENERMHIEALRRLTSSKGWKLSKRFSLLNYLWFITGTVVMVATRKHTKNYYLWFISWTI
ILSCIFRVFFTIIWFCFFFPYHQNIPKKKKGVPKAFLAEIPTFKYSSDRKLKNESCSICL
SDFVEKDEIFEFRCMHNFHTKCAKKWLSQRRQCPLCQRDVMKLD
Download sequence
Identical sequences A0A077XHT8 A0A113SEI1 Q4Z0D6
PBANKA_124430 XP_679553.1.11252 gi|68075271|ref|XP_679553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]